silico.biotoul.fr
 

TD1 Genome Selection Plantes

From silico.biotoul.fr

Revision as of 15:39, 7 November 2019 by Gaulin (Talk | contribs)
(diff) ← Older revision | Current revision (diff) | Newer revision → (diff)
Jump to: navigation, search

Contents

Objectifs

Ce TD a pour but de vous familiariser avec la recherche d'informations scientifiques disponibles dans les banques de données biologiques (Database) et des outils permettant de comparer des séquences pour définir leur lien d'homologie

Globalement les informations sont regroupées dans 2 centres :

  • NCBI National Center for Biotechnology Information (NIH, USA)
  • EBI European Bioinformatics Institute (EMBL, GB)

Exercice 1 : Recherche dans les banques de données par numéro d'accession ou mots clés (EBI & NCBI)

1/ Aller sur le site de EBI - European Bioinformatics Institute

  • rechercher Uniprot (DataResources>SeeAllDataResources>Uniprot), qu'est ce que Uniprot ?
  • combien de séquences sont référencées dans TrEMBL ?
  • combien de séquences sont référencées dans Uniprot/swissProt ?


2/Sur le site d' UniProt : chercher la séquence dont le numéro d'accession est P01308.

  • de quelle protéine s'agit-il ? chez quel organisme ?
  • quelle est la taille de cette séquence ?
  • y a-t-il des preuves expérimentales de l'existence de cette protéine ?
  • est-elle dans UniProt-trEMBL ou UniProt-SwissProt ?
  • afficher la fiche au format UniprotKb. Particularité du format de la la fiche ? (en haut de la page>Format>text)


3/Aller sur le site du NCBI: identifiez

  • toutes les séquences de l'oomycète Phytophthora (parasite de la pomme de terre), combien sont-elles ?
  • les séquences protéiques de Phytophthora parasitica pouvant interagir avec la cellulose

Pour cela sur le site du NCBI sélectionnez les banques "protéines", puis dans la barre de requête il est possible de combiner plusieurs termes à l'aide des opérateurs booléens (AND, OR, NOT) puis l'option Advanced (sous la barre de requête) et le bouton Preview, en précisant les champs, Organism, Title... à l'aide de l'outil Search builder et conjuguer vos requêtes. L'historique de vos requêtes est visible.

On s'intéresse maintenant à la séquence dont le numéro d'accession est CAA65843

Regardez la fiche de la séquence correspondante :

  • comment s'organise cette fiche ? (format GenPept # UniprotKb)
  • quel est le nom de cette protéine ?
  • quel le nombre d'acides aminés constituant cette protéine ?
  • dans quel journal scientifique les travaux concernant cette protéine ont-ils été publiés ?
  • sous quel numéro cette publication est-elle référencée dans PubMed ?


On s'intéresse maintenant aux références croisées, notées "db_xref" sur la fiche

  • à quoi correspondent les différents liens croisées :

- db_xref="InterPro:IPR000177" - db_xref="InterPro:IPR000254" - db_xref="UniProtKB/TrEMBL:O42830

  • quels domaines protéiques sont présents dans la protéine ?
  • définissez l'architecture de cette protéine
  • affichez votre séquence protéique au format FASTA (haute de page>FASTA). Qu'est ce que le format FASTA ?


Exercice 2 : Recherche dans les banques via une séquence (protéique ou nucléique): l'outil BLAST

Ci-dessous une séquence protéique inconnue au format FASTA

>sequence_proteique_inconnue
HAILRLDLAGRDLTDHSSSILTERGYSQTTTAEREIVRDMKEKVSYIALDYEQELETSKTAAAVEKSFELPDGQVITIGVERFRCPEVLFQPSMIGMENPGIHETTYNSI

  • Afin de savoir si cette séquence est répertoriée dans les bases de données faites un BLAST au NCBI ou auprès de l'EBI.
  • Quel type de 'Blast' choisissez-vous ? Faites un Blast contre la banque de données UniprotKB/SwissProt
  • A quoi correspond la E-value ?

Regardez un alignement entre votre séquence requête appelée QUERY et la séquence présentant une homologie et répertoriée dans les banques de données (SUBJECT)

  • Qu'indique les signe '+' et ' rien ' dans la ligne intermédiaire de l'alignement ?
  • Votre séquence QUERY présente-elle des similarités avec d'autres séquences ? Si oui, sur quelle partie ?


Ci-dessous une séquence nucléique inconnue au format FASTA

>sequence_nucleique_inconnue

GGCAACTTCAACTGGGGCCGGGTGGTTGCCCTTTTCTACTTTGCTAGCAAACTGGTGCTCAAGGCCCTGTGCACTAAAGTGCCCGAGCTGATCAG AACCATCATGGGCTGGACACTGGACTTCCTCCGGGAGCGGCTGCTTGTCTGGATCCAAGACCAGGGTGGC TGGGATGGCCTCCTTTCCTACTTCGGGACCCCCACATGGCAGACAGTGACCATCTTTGTGGCTGGAGTCC TCACTGCCTCACTCACCATCTGGAAGAAGATGGGCTGAGGCTTCCTGCTGCCTTGGACTGTGTCTTTTCT TCATAAATTATGACATTTTTCCTGGGATGAATGGGGAACGGGGAAAGGCATTTTCCCCGTGAGGGCCGCACGTCTGCTCTTACTTTTGTAATT ATTGGGAGGGGTGGGAATGGTGGCCTGGGGGAGGTGCCAATAAACCTCAGGTCCA

  • Quelle est la nature (ADN, ARN..) de cette séquence ?
  • Est-elle répertoriée dans les bases de données ?
  • Présente-elle des similarités avec d'autres séquences ?

Visualisez un alignement entre votre séquence QUERY et une séquence répertoriée dans la base de donnée

  • Sur quel brin cette séquence inconnue présente-elle une homologie ?
  • Que représente les signes '--------' rencontrés sur certaines séquences ?

Mise en Application

Vous diposez de la séquence ci-dessous

>seq1

attggcaacctgaaagatctgaacattctgtatctgcatagcaacggctttaccggccgc attccgcgcgaaatgagcaacctgaccctggcgaacctgaccgatctggatctgagcggc aaccagctgaccggcaaaattccgcgcgattttgcggcgctgctgctggtgctgctggaa aaaaaaattgaaaacattacctgcgatagcatgaaactgctgagcaaaacctttctgatt ctgaccctgaccttttttttttttggcattgcgctggcgaaacagagctttgaaccggaa attgaagcgctgaaaagctttaaaaacggcattagcaacgatccgctgggcgtgctgagc gattggaccattattggcagcctgcgccattgcaactggaccggcattacctgcgatagc accggccatgtggtgagcgtgagcctgctggaaaaacagctggaaggcgtgctgagcccg gcgattgcgaacctgacctatctgcaggtgctggatctgaccagcaacagctttaccggc aaaattccggcggaaattggcaaactgaccgaactgaaccagctgattctgtatctgaac tattttagcggcagcattccgagcggcatttgggaactgaaaaacattttttatctggat ctgcgcaacaacctgctgagcggcgatgtgccggaagaaatttgcaaaaccagcagcctg gtgctgattggctttgattataacaacctgaccggcaaaattccggaatgcctgggcgat ctggtgcatctgcagatgtttgtggcggcgggcaaccatctgaccggcagcattccggtg agcattggcaccctggcgaacctgaccgatctggatctgagcggcaaccagctgaccggc aaaattccgcgcgattttggcaacctgctgaacctgcagagcctggtgctgaccgaaaac ctgctggaaggcgatattccggcggaaattggcaactgcagcagcctggtgcagctggaa ctgtatgataaccagctgaccggcaaaattccggcggaactgggcaacctggtgcagctg caggcgctgcgcatttataaaaacaaactgaccagcagcattccgagcagcctgtttcgc ctgacccagctgacccatctgggcctgagcgaaaaccatctggtgggcccgattagcgaa gaaattggctttctggaaagcctggaagtgctgaccctgcatagcaacaactttaccggc gaatttccgcagagcattaccaacctgcgcaacctgaccgtgctgaccgtgggctttaac aacattagcggcgaactgccggcggatctgggcctgctgaccaacctgcgcaacctgagc gcgcatgataacctgctgaccggcccgattccgagcagcattagcaactgcaccggcctg aaactgctggatctgagccataaccagatgaccggcgaaattccgcgcggctttggccgc atgaacctgacctttattagcattggccgcaaccattttaccggcgaaattccggatgat atttttaactgcagcaacctggaaaccctgagcgtggcggataacaacctgaccggcacc ctgaaaccgctgattggcaaactgcagaaactgcgcattctgcaggtgagctataacagc ctgaccggcccgattccgcgcgaaattggcaacctgaaagatctgaacattctgtatctg catagcaacggctttaccggccgcattccgcgcgaaatgagcaacctgaccctgctgcag ggcctgcgcatgtatagcaacgatctggaaggcccgattccggaagaaatgtttgatatg aaactgctgagcgtgctggatctgagcaacaacaaatttagcggccagattccggcgctg tttagcaaactggaaagcctgacctatctgagcctgcagggcaacaaatttaacggcagc attccggcgagcctgaaaagcctgagcctgctgaacacctttgatattagcgataacctg ctgaccggcaccattccgggcgaactgctggcgagcctgaaaaacatgcagctgtatctg aactttagcaacaacctgctgaccggcaccattccgaaagaactgggcaaactggaaatg gtgcaggaaattgatctgagcaacaacctgtttagcggcagcattccgcgcagcctgcag gcgtgcaaaaacgtgtttaccctggattttagccagaacaacctgagcggccatattccg gatgaagtgtttcagggcatggatatgattattagcctgaacctgagccgcaacagcttt agcggcgaaattccgcagagctttggcaacatgacccatctggtgagcctggatctgagc agcaacaacctgaccggcgaaattccggaaagcctggcgaacctgagcaccctgaaacat ctgaaactggcgagcaacaacctgaaaggccatgtgccggaaagcggcgtgtttaaaaac attaacgcgagcgatctgatgggcaacaccgatctgtgcggcagcaaaaaaccgctgaaa ccgtgcaccattaaacagaaaagcagccattttagcaaacgcacccgcgtgattctgatt attctgggcagcgcggcggcgctgctgctggtgctgctgctggtgctgattctgacctgc tgcaaaaaaaaagaaaaaaaaattgaaaacagcagcgaaagcagcctgccggatctggat agcgcgctgaaactgaaacgctttgaaccgaaagaactggaacaggcgaccgatagcttt aacagcgcgaacattattggcagcagcagcctgagcaccgtgtataaaggccagctggaa gatggcaccgtgattgcggtgaaagtgctgaacctgaaagaatttagcgcggaaagcgat aaatggttttataccgaagcgaaaaccctgagccagctgaaacatcgcaacctggtgaaa attctgggctttgcgtgggaaagcggcaaaaccaaagcgctggtgctgccgtttatggaa aacggcaacctggaagataccattcatggcagcgcggcgccgattggcagcctgctggaa aaaattgatctgtgcgtgcatattgcgagcggcattgattatctgcatagcggctatggc tttccgattgtgcattgcgatctgaaaccggcgaacattctgctggatagcgatcgcgtg gcgcatgtgagcgattttggcaccgcgcgcattctgggctttcgcgaagatggcagcacc accgcgagcaccagcgcgtttgaaggcaccattggctatctggcgccggaatttgcgtat atgcgcaaagtgaccaccaaagcggatgtgtttagctttggcattattatgatggaactg atgaccaaacagcgcccgaccagcctgaacgatgaagatagccaggatatgaccctgcgc cagctggtggaaaaaagcattggcaacggccgcaaaggcatggtgcgcgtgctggatatg gaactgggcgatagcattgtgagcctgaaacaggaagaagcgattgaagattttctgaaa ctgtgcctgttttgcaccagcagccgcccggaagatcgcccggatatgaacgaaattctg acccatctgatgaaactgcgcggcaaagcgaacagctttcgcgaagatcgcaacgaagat cgcgaagtg


Répondez aux questions suivantes:

  • A quel organisme appartient cette séquence ?
  • cette séquence est-elle codante ?
  • quelle est le numéro d'accession de cette protéine, de l'ARNm, du gène ?
  • quelle est la fonction putative de cette protéine ?



Exercice 3: Comparaison de 2 séquences par alignement global et local : Cas d'Ecole

Les logiciels utilisés pour la comparaison de séquences deux à deux sont disponibles dans la suite EMBOSS de la Genopole de Toulouse ou du centre de Bioinformatique des Pays Bas


Voici 2 séquences, au format FASTA :

>prot1

MVMEYLVLEKRLKRLREVLEKRQKDLIVFADNVKNEHNFSAIVRTCDAVGVLYLYYYHAE GKKAKINEGITQGSHKWVFIEKVDNPVQKLLEFKNRGFQIVATWLSKESVNFREVDYTKP TVLVVGNELQGVSPEIVEIADKKIVIPMYGMAQSLNVSVATGIILYEAQRQREEKGMYSR PSLSEEEIQKILKKWAYEDVIKERKRTLSTS

>prot2

MVMEYLVLEKRLKRLREVLEKRQKDLIVFADNVKNEHNFSAIVRTCDAVATWLSKESVNF REVDYTKPTVLVVGNELQGVSPEIVEIAVGVLYLYYYHAEGKKAKINEGI


  • Faites une matrice de point (Dot plot), pour comparer vos 2 séquences et obtenir un aperçu de la similarité entre les 2 séquences.

Utilisez l'outil DOTMATCHER disponible sur EMBOSS en gardant les paramètres par défaut, et qui permet de visualiser des diagnonales de 'similarité'

Que pouvez-vous conclure ?


  • Faites un alignement global pour comparer de bout à bout (du premier jusqu'au dernier résidu) vos 2 séquences

Utilisez l'outil d'alignement global Stretcher' disponible sur EMBOSS en gardant les paramètres par défaut

Qu'observez vous ?
Combien y a-t-il de gaps ? A quoi correspondent-ils ?
A quoi correspond le pourcentage de similarité ?
Quels sont les paramètres de calcul du score ?
Votre alignement est-il significatif ?


  • Faites un alignement local pour comparer vos 2 séquences et identifier les régions similaires

Utilisez l'outil d'alignement local Matcher disponible sur EMBOSS.
NB: dans 'alternative matches' indiquez 10, de façon a visualiser 10 alignements locaux

Qu'observez-vous ?
Regardez les autres alignements locaux. Sont-il significatifs ?

NB: si vous avez besoin de convertir vos séquences au Format Fasta un petit outil bien utile  :ReadSeq


Exercice 4 : Comparaison de plusieurs séquences par alignement multiple

L'idée maintenant est de comparer plusieurs séquences similaires entre elles, afin par exemple d'identifier des 'zones' (domaines/motifs) conservés pouvant décrire une famille protéique

Sur le lien suivant, vous trouverez un ensemble de séquences protéiques de la famille THAP au format FASTA appartenant à l'homme, la souris, le poulet et le poisson zèbre (~30 séquences) et connues pour être impliquées dans des phénomènes d'apoptose.


  • Réalisez un alignement 'multiple, c'est à dire de l'ensemble des séquences

Pour cela utilisez le logiciel Clustal Omega disponible a l'EBI (>DataResources)

Qu'observez-vous ?


  • Trouvez-vous des 'zones similaires' (=domaines) à l'ensemble de ces séquences.

NB : Le motif 'AVPTIF' marque une partie d'une zone similaire/domaine : le trouvez-vous ?

Nous allons maintenant essayer de construire un pattern/signature caractéristique de cette famille de protéine THAP en se basant sur les 'zones similaires' préalablement identifiées

  • Construire une signature PROSITE à partir de votre alignement
   Voici l'exemple d'un début d'une signature (ou pattern) : Q-L-x(3)-P-x(6)-[FY]-x(2)-V-x(3)-[LVF]-[FGD]-x(2,8)-[GPS]

Comment lire cette signature ?

    Q-L : il n'y a que les acides aminés Q puis L dans 2 colonnes successives de l'alignement 
x(3) : 3 colonnes avec des acides aminés variables
[FY] : dans cette colonne seuls les acides aminés F ou Y sont présents
x(2,8) : zone avec un gap. Entre 2 et 8 résidus (acides aminés) quelconques, suivant les séquences
  • Tester la spécificité de votre signature sur ScanProsite (choisir l'option 2) contre SwissProt
Qu'observez-vous, sachant que 45 séquences protéiques de la famille THAP sont disponibles dans la banque de données SwissProt ?
Que pensez-vous de la signature suivante C-x(4)-C-x(9,15)-[FL]-x(2)-[FL]-P-x(8,9)-W ?