silico.biotoul.fr
 

M1 Genomique Evolutive et Phylogenie - TP 2 Evolution proteine d'oomycete

From silico.biotoul.fr

Jump to: navigation, search

Contents

Introduction

Les oomycètes sont des microorganismes eucaryotes filamenteux, occasionnant d’importants dégâts sur les plantes de grande culture comme le soja ou la pomme de terre. Les analyses de phylogénie moléculaire ont permis de positionner les oomycètes dans l’ordre des Heterokonts avec pour plus proches voisins

  • les diatomées (Thalassossira pseudonana)
  • les algues brunes (Ectocarpus siliculosus).

Ainsi malgré leur ressemblance morphologique, les oomycètes sont phylogénétiquement distincts des Fungi (Champignons) qui appartiennent à l’ordre des Opisthokonts.

File:oomycete-arbre.jpg


De par leur position distincte par rapport aux champignons, les moyens de lutte phytosanitaire développés contre les champignons, restent peu efficaces envers les oomycètes. Ainsi nombreuses sont les recherches qui visent à mieux caractériser les acteurs moléculaires impliqués dans la virulence de ces microorganismes afin de développer des moyens de lutte plus efficace.

Objectifs et Contexte Scientifique du TP

L’équipe du Dr Jones à partir d’un milieu de culture de l’oomycète Phytophthora sojae (parasite du soja) a purifié la protéine Physo_12. L’équipe souhaite maintenant définir la fonction de cette protéine et son histoire évolutive, afin d’établir si Physo_12 pourrait être un facteur de virulence du microorganisme, c'est-à-dire une protéine qui faciliterait l’infection/colonisation de l’hôte végétal.

L’ensemble des exercices du TP a pour but de répondre à ces deux objectifs. Il est basé sur des travaux publiés par Richards et al., 2011, PNAS

Exercice 1

>Physo_12
MKVLFATALTAAAVAVASAAEFCDQWGQAKSGNYIIYNNLWGSSAANPGGKQCTALDSGS
GDSVAWHTTWSWQGGDKSVKSFANAALEFDPVPLSEVKSIPSTMAYTVKSKGKAVTDVAY
DLFTSSTAKGEKEFEIMIWLAALGGAGAISSTGKPIASTTIAGTEWSVYKGPNGSMMVYS
FVASKQVENFEGDLLEFFNYLVKEQGFKTSQFLIKVECGTEPFVGTDVTMTVSKYSAAVN
TSGGSSTPTQSGESSSSTEQTTTAPAASNTGSSAEQTTPAPAESNTGSSAEQTTPAPAGS
DAGSSEEQTPSTPSTGSSTEQTTDAPAASNTGSSEETPSTGSSEETPSTGSSEETPATSD
AGSSEETPATSSTGSSEETPVESSTGSSEQNPGQQEPSTPTTSSSSEETPSTETNPKCVL
RRVRRE

A partir de la séquence en acide aminé de Physo_12, établissez quelle peut-être la fonction putative de cette protéine. Pour cela, suivez la procédure décrite ci-dessous

1/ Recherche dans les banques de domaines protéiques

  • utilisez InterProScan à l'EBI (Services => Proteins => InterProScan) pour identifier si la séquence Physo_12 contient des domaines protéiques
  • que signifie PF01670 et IPR002594
  • relevez la position des différents domaines prédits par PFAM

2/ Recherche de séquences 'signales'

  • utilisez SignalP3.0 au CBS avec la sequence Physo_12 en gardant les paramètres par défaut
  • que permet d'identifier ce logiciel ?
  • expliquez pourquoi les auteurs ont purifie Physo_12 à partir du milieu de culture de Phytophthora sojae

3/ Recherche dans les banques de données

  • sur le site du NCBI identifiez Physo_12 dans les banques de données
  • quel est son numero d'accesion et son 'surnom' ?
  • Physo_12 est-elle annotée comme une protéine sécrétée par le microorganisme ?
  • qu'obtenez-vous comme informations supplementaires sur la fiche GenPept de Physo_12 ?
  • enregistrez sur vos ordis, au format fasta le transcit de Physo_12

4/ Conclusion sur l'analyse de Physo_12

Exercice 2

On souhaite maintenant déterminer l’histoire évolutive de Physo_12. Pour cela, un arbre phylogénétique incluant Physo_12 doit être réalisé. Il faut donc définir s’il existe des homologues à la protéine Physo_12, collecter les séquences correspondantes et réaliser l’arbre.

1/ Collecte des séquences

  • Etablissez s’il existe des homologues à Physo_12, répertoriés dans les banques de données via une analyse BlastP au NCBI sur la banque 'nr'
  • A quel groupe du vivant appartiennent les séquences homologues les plus proches ?
  • Extraire et enregistrez les séquences d’oomycètes au format fasta
  • Rechercher si il existe des homologues de Physo-12 dans les banques de données fongiques (génomes complets) en utilisant le serveur dédié

du JGI. Si l'analyse est fastidieuse ou trop longue vous pouvez utiliser les séquences fongiques ci-dessous

Fungal_sequences
  • Recherchez si il existe des homologues chez les bactéries sur le site du du NCBI par BlastP (Microbes).

Dans Microbes: Sélectionner le génome de Bacillus licheniformis (Firmicute, Bacillales) et Streptomyces avermitilis (Bacteria, Actinobacteria)

  • Extraire et enregistrez les séquences de bactéries au format fasta


2/ Création du jeu de données

  • Rassembler toutes les séquences collectées (bactéries, oomycètes, champignons) et Physio_12 dans un seul fichier, au format fasta.
  • Renommer les séquences pour faciliter la lecture de l'arbre phylogénétique
exemple: >gi|301111712....putative [Phytophthora infestans T30-4]    devient >Phyin
Evitez les espaces, caractère de ponctuation...
  • Sauvegardez votre nouveau fichier fasta


3/ Obtention de l'arbre phylogénétique

  • Réalisez un alignement multiple de vos séquences, avec le logiciel ClustalW
  • Sauvegardez votre alignement au format texte (bas de la page du resultat ClustalW)
  • Ouvrez votre alignement dans le logiciel de constrcution d'arbre (SeaView, ClustalW...)
  • Faites un arbre phylogénétique (methode de distance) et effectuez 1000 bootstrap. Affichez les valeurs de boostrap sur les branches. Qu’observez-vous ?
  • Gardez votre arbre affiché à l'écran ou sauvegardez-le
  • Faites la même chose avec les séquences protéiques d’ATP synthase ci-dessous
ATPsynthase_sequences
  • Gardez votre arbre affiché à l'écran ou sauvegardez-le


4/ Comparaison d'arbres

  • Comparez l'arbre obtenu avec les homologues de Physo_12 et celui des ATPases
  • Pourquoi comparer les arbres
  • Qu’en concluez-vous?


Références

Publication de reference
Publication de reference, supplementary data