silico.biotoul.fr
 

TD5 Bioanalyse

From silico.biotoul.fr

Jump to: navigation, search

Contents

EXERCICE 1 : caractérisation d'une protéine

A partir de la protéine suivante, faites une recherche de domaine sur InterProScan :

>NP_060575.1| THAP domain-containing protein 1 isoform 1 [Homo sapiens]
MVQSCSAYGCKNRYDKDKPVSFHKFPLTRPSLCKEWEAAVRRKNFKPTKYSSICSEHFTPDCFKRECNNK
LLKENAVPTIFLCTEPHDKKEDLLEPQEQLPPPPLPPPVSQVDAAIGLLMPPLQTPVNLSVFCDHNYTVE
DTMHQRKRIHQLEQQVEKLRKKLKTAQQRCRRQERQLEKLKEVVHFQKEKDDVSERGYVILPNDYFEIVE
VPA

Il se peut que cette nouvelle interface ne marche pas sur votre PC... essayez alors ici

Vous devez trouver un domaine C2CH-type, nommé THAP :

  • Quelles sont les positions du domaine selon les banques ?
  • Regarder le domaine dans PFAM et dans PROSITE (il faut cliquer le numéro d'accession, puis sur le lien dans External links): faites afficher les Logos.

Pourquoi sont-ils si différents ?

EXERCICE 2 : recherche d'homologues

A partir de la séquence précédente, lancer un BLASTP au NCBI contre la banque SwissProt, en changeant Expect threshold (E-value) à 10 (algorithm parameters)

  • Regardez les résultats : sur quelle partie trouvez-vous des séquences alignées ?

En fait la famille des protéines THAP contient différents paralogues chez chaque espèce (appelés de THAP 1 à THAP 11) qui n'ont en commun que le domaine THAP situé en position N-terminale. Il y a par contre une très bonne conservation entre orthologues (THAP 1 chez l'homme, souris, zebrafish par exemple)

  • Passer par l'onglet Taxonomy (en haut de la page) et récupérer les séquences de Primates, au format FASTA (cliquer sur le chiffre (15) à côté du premier mot primates, puis Fasta text)

Vous devez avoir 15 séquences. Mettez ces séquences dans un éditeur de texte et renommez-les pour que le nom apparaissent juste après le '>'. Exemple : >THAP1_HUMAN

EXERCICE 3 : recherche dans les banques par mots-clés

Sur le site du NCBI, via ENTREZ, chercher les protéines THAP de souris, poulet et zebrafish, dans la banque RefSeq. (vous chercherez 'THAP' dans [Title] ici)
Parmi les résultats que vous avez, beaucoup de séquences sont des RefSeq models (numéro d'accession en XP_). Elles sont le résultats de prédiction automatique avec gnomon (ouvrez une des fiches de séquences pour le vérifier, en regardant la partie 'COMMENT'). Faites une requête pour les supprimer.

Vous devez avoir 15 séquences

  • Pour vous assurer que ces séquences possèdent bien un domaine THAP, cliquez sur Identify Conserved Domains with CD-search, à droite, : que constatez-vous ? les séquences ont-elles toutes un domaine THAP ?
  • Choisissez un programme de EMBOSS pour comparer les protéines THAP 4 humaine (exercice 2) et celle de zebrafish : qu'en concluez-vous quant à l'annotation de la protéine de zebrafish ?
  • Récupérez les séquences (possédant un domaine THAP) au format FASTA. Mettez-les dans l'éditeur de texte et renommez-les, avec la même nommenclature qu'à l'exercice 2

EXERCICE 4 : alignement multiple

A partir de l'ensemble des séquences que vous avez récupéré (exercice 2 + exercice 3):

  • Faites un alignement multiple avec MAFFT à l'EBI.

En regardant cet alignement, vous devez retrouver la signature suivante : M-x(3,4)-C-x(4)-C-x(9,15)-[FL]-x(2)-[FL]-P-x(8,9)-W

  • Essayez de construire une signature PROSITE (pattern) sur la fin du domaine THAP
  • Regardez sur quelles séquences de SwissProt sont retrouvées ces 2 signatures (vous pouvez écrire 2 signatures, séparées par "and"(en minuscule)) avec ScanProsite (option 2).
  • Calculez la spécificité et la sensibilité de votre signature.

Voir le cours ici pour le calcul

Annexes

Les séquences

Résultat de InterProScan

Résultat de MView

Résultat de ScanProsite